mercredi 30 décembre 2020 - par Bernard Dugué

SARS-CoV-2, personnalité de l’année 2020 ! Qui es-tu, virus ?

 

 Le SARS-CoV-2 est la personnalité de l’année. Aucun humain ne peut lui contester cette place d’autant plus que tous les acteurs en vue de notre monde n’ont guère brillé.

JPEG

 Aussi impensable que cela puisse être, une petite particule de matière composée d’un génome enveloppé avec une taille de 100 nanomètres a réussi à mettre à genoux toutes les nations du monde, y compris la superpuissance américaine et tous les pays disposant d’un système de santé parmi les plus performants. La science a révélé son impuissance mais n’a pas chômé, accumulant des milliers d’études publiées en accès libre dans les prestigieuses revues scientifiques. Nous savons dans les moindres détails comment le virus fonctionne, nous connaissons sa séquence, ses mutations, nous savons pourquoi il infecte les tissus et déclenche des formes graves de maladie, mais nous ne savons pas comment le combattre.

 

 1) Comment le SARS-CoV-2 entre dans les cellules. Le H-CoV de 2019 utilise comme la plupart des virus une protéine de surface permettant d’adhérer à la membrane hôte, puis de fusionner pour entrer dans le cytoplasme. Pour les coronavirus, c’est la protéine S qui est utilisée. C’est cette protéine qui est responsable de la contagiosité élevée du SARS-CoV-2 et de la gravité de l’infection pour une partie des infectés. Cette protéine contient deux codes d’entrée permettant de fusionner, un code trypsine et un code furine. Le code trypsine figure sur le SARS-CoV ayant causé les quelque 800 décès lors de l’épidémie de pneumonie en 2003. Ce code qui s’écrit lkptkrs figure sur les souches de la sous-famille sarbecovirus dont le réservoir inclut les chauves-souris et la civette palmée (d’ailleurs, des employés d’un restaurant chinois ont été contaminés en 2004 par un virus présent sur les civettes conservées dans des cages avant d’être sacrifiée pour le plaisir des gourmets).

 La protéine S du nouveau virus possède un code trypsine assez proche, skpskrs, retrouvé dans un réservoir incluant les pangolins et les chauves-souris (il a été retrouvé en Chine mais aussi au Japon). En plus, le SARS-CoV-2 possède un second code furine, absent sur le virus de 2003 et d’autres coronas. C’est ce code qui rend le virus plus contagieux car il étend considérablement le tropisme viral et donc sa multiplication. La présence de ce code a nourri nombre de spéculations sur un bricolage virologique suivi d’un accident de laboratoire. Pourtant, une origine naturelle semble plus plausible. Il est connu depuis plus de trente ans que les coronavirus ont une faculté de recombinaison liée entre autres à la transcription imbriquée produisant des ARN subgénomiques.

Publicité

 Pour compléter ce volet virologique, il faut évoquer la protéine N de la nucléocapside, moins connue que S et pour cause, elle n’est pas ciblée par les vaccins. Cette protéine a la particularité d’être extrêmement conservée, plus que toute autre, au sein des souches occupant le réservoir des sarbecovirus. Plusieurs motifs peptidiques sont conservés à l’identique et se retrouvent sur une souche prélevée en 2020 sur un pangolin, ainsi que sur les souches RaTG13 et Rc-o319, prélevées en 2013 sur des chauves-souris, l’une en Chine, l’autre au Japon. Ce détail confirme la provenance animale du SARS-CoV-2, suivie d’une recombinaison on ne sait où ni comment. Cela dit, si un virologue avait voulu créer une souche virulente et transmissible, il aurait inséré le code furine dans la protéine S. Il est bien connu que ce code rend un agent hautement transmissible. Cela a été observé pour les hémagglutinines grippale H5 et H7.

 

 2) Comment la pathologie Covid-19 se développe. Une fois dans la cellule hôte, le virion se dissocie et son génome parvient aux ribosomes où il est traduit. Les protéines virales non structurales parviennent à hacker les codes cellulaires, à détourner les voies de signalisation, et c’est la reproduction des virions qui se met en route. Pendant ce temps, les récepteurs TLR détectent les protéines virales, déclenchent les alertes en activant les interférons I, II et III grâce à une signalisation par le facteur nucléaire kappa (NFκ-B). Ces signaux interférons se propagent par contigüité dans les tissus infectés afin d’alerter les cellules sur l’invasion virale. Dans le même temps, les mécanismes de l’immunité et de l’inflammation sont déclenchés selon la nécessité. Une course contre la montre est engagée, entre la propagation des virions et la riposte des cellules hôtes. Cette réaction nécessite la production de cytokines avec un réglage fin. Cet ajustement est réalisé par des protéines kinase de type JAK, désignées ainsi car elles produisent des effets salvateurs ou à l’inverse, dévastateurs. Le J de Janus. Dévastateurs comme dans les formes graves de Covid-19 dont on pense maintenant connaître l’origine moléculaire.

 Les protéines des deux SARS-CoV rendent inopérante la voie de signalisation STAT1, ce qui fait basculer le système vers l’autre voie, STAT3. Cette signalisation active les cascades de cytokines inflammatoires, ce qui produit alors les symptômes graves, proto-fibrose pulmonaire, micro-thromboses, coagulations, inflammation systémique, et notamment la lymphopénie causée par la reproduction des virions du SARS dans les cellules T. Il semble établi que deux protéines virales ont un effet désactivant sur STAT1, ce qui induit une hyperactivation de STAT3 qui en plus de déclencher les cytokines joue sur le facteur PAI-1, qui alors interfère avec la plasminogenèse dont le rôle est de détruire les micro-caillots sanguins.

 

 3) Le spectre clinique du Covid aggravé livre un profil qui pratiquement se superpose avec le profil des patients présentant une altération au niveau du PAI-1. Cette altération est liée à un état physiologique classique, celui d’une inflammation chronique à bas bruit qui n’empêche pas de vivre mais qui, dans le cas d’une infection virale, pose de graves problèmes. Cet état se retrouve dans l’obésité, le diabète de type 2 (dit gras et souvent lié à la mal bouffe), l’hypertension, les pathologies cardiovasculaires et surtout le grand âge. Les données cliniques indiquent que la proportion d’individus en surpoids (IMC >30) avoisine le tiers aux Etats-Unis, tourne entre 20 et 25 en Europe, alors qu’il est de 5 à 6 dans nombre de pays asiatiques et africains, Inde incluse et 3 pour le Japon.

 

 4) Nous savons presque tout sur le plan clinique et virologique mais... Un angle mort majeur persiste en épidémiologie. Aucune projection ne permet de prévoir la situation à moyen terme. Les seules anticipations couvrent une période comparable aux prévisions météo. La stratégie sanitaire n’est pas débattue. Il existe la voie de l’immunité collective qui ne s’oppose pas à la stratégie vaccinale. On ne peut pas stopper un virus comme le SARS-CoV-2 qui n’a rien de commun avec la variole ou le SARS de 2003. C’est comme si l’on voulait éradiquer les virus grippaux. Et dire qu’il y a des scientifiques sérieux qui visent cet objectif inatteignable et du reste non indispensable. Plus vite les jeunes et bien portants seront infectés, moins le virus aura de part de marché. Les asymptomatiques sont plus nombreux que les chiffres ne l’indiquent.

Publicité

 

 5) C’est quoi un virus ? D’après Jean-Michel Claverie, un virus est ce qui transforme une cellule en usine à virion. C’est la meilleure définition que je connaisse. Le SARS-CoV-2 impose une seconde définition. Ce virus a transformé les sociétés en usines à Covid, pour reprendre un « bon mot » du PM Castex prononcé en évoquant les fêtes de Noël. L’usine à Covid fonctionnera aussi le soir du 31 décembre. L’épidémie de Covid a transformé les sociétés. Elle a favorisé l’émergence d’une sorte de barbarie, certes pas comme au temps du nazisme ou du stalinisme, mais une barbarie douce, atténuée au point d’être acceptée par une majorité de concitoyens en demande de confinements, restrictions, masques, pour une durée indéterminée. J’en connais qui accepteraient de porter le masque pendant des années. Je croise dans la rue des gosses de 6 à 10 ans portant le masque. Si ce n’est pas de la barbarie, qu’est-ce donc ? Le Covid a révélé qui nous sommes au fond. Porter des jugements de valeur n’apportera pas grand-chose vu que les gens ne savent plus ce que sont les valeurs. Nous assistons pour l’instant à un lent dépérissement de la civilisation

 

------------------

 

 C’est quoi un virus ? Nous ne savons pas trop en vérité ce que représente un virus dans le monde vivant, en sachant que toute entité possédant la capacité de se reproduire de manière autonome avec un génome et le métabolisme, est susceptible d’être infectée par un virus qui lui, ne peut pas se reproduire car il ne dispose ni de l’appareil métabolique qui produit les pièces détachées, ni le système moléculaire industriel qui fabrique les protéines. Tout au plus un virus possède une réplicase capable de copier son génome mais en utilisant les pièces détachées (nucléotides) de l’hôte, ainsi que son énergie efficiente (ATP). Les virus infectent les archea, les procaryotes et les eucaryotes ; comprenant les systèmes unicellulaires, les végétaux, champignons et animaux.

 Je crois que de grandes découvertes sont en vue en cette époque de ténèbres en attente d’être éclairée par des paradigmes nouveaux et qui sait, une étonnante version de la gravité quantique en relation avec l’intrication. Nous ignorons le pourquoi et le pour - quoi des virus parce que nos méthodes de pensée scientifique sont impuissantes. La science est un ensemble de savoirs accompagnés d’ignorance. Seules les révolutions savantes peuvent faire sortir les scientifiques de l’ignorance. Les données sont accessibles. Les grandes découvertes arrivent en voyant ce que tout le monde a en vue et en pensant ce que personne n’a osé penser disait à peu près Szent-Györgyi en 1957. Le 21ème siècle sera celui de la pensée, sinon, il ne sera qu’un naufrage !

 



34 réactions


  • Séraphin Lampion Séraphin Lampion 30 décembre 2020 08:25

    Vous avez aimé 2020 ? Vous adorerez 2021 qui s’annonce encore plus passionnant avec la nomination de M. Yazdan Yazdanpanah comme nouveau gourou.


  • Bendidon Bendidon 30 décembre 2020 10:08

    Merci pour cet article récapitulatif mais il serait quand même grand temps de se poser DEUX QUESTIONS fondamentales :

    1) D’où vient ce virus ?

    D’une copulation entre un pangolin et une chauve souris ou d’un labo P4 !

    2) Pourquoi se propage t-il si vite dans le monde et par quels moyens ?

    Une chose est sure c’est un instrument très efficace pour faire une grande réinitialisation (RESET)

     smiley



    • Bernard Dugué Bernard Dugué 30 décembre 2020 11:36

      @Bendidon J’ai donné quelques indications sur l’origine du virus dans l’article
      pour info, énième mise au point, un corona se manipule dans un P3
      Pourquoi il se propage ? Eh bien parce que les gens prennent l’avion et qu’il est très contagieux. Les contaminés prennent l’avion. Le virus utilise un autre moyen de transport aérien, la gouttelette nasale, invisible à l’oeil nu. 


    • Shawford Shawford 30 décembre 2020 11:38

      @Bernard Dugué

      Laisse béton Bernardo, y’a que des P4 ici !

       smiley smiley smiley

      smiley


    • Shawford Shawford 30 décembre 2020 11:40

      @Shawford

      Oups ... signé TON P5ème Soleil intérieur au NadirSabir, entre La Rèole et Marmande, entre 3et 6 h du mat’ ! ^^


    • Shawford Shawford 30 décembre 2020 11:41

      @Bernard Dugué

      Réponse interdîtes sauf si t’as à dire schiste là-dessus -> https://youtu.be/SSbBvKaM6sk


    • Bernard Dugué Bernard Dugué 30 décembre 2020 13:11

      @Bendidon
      ORF6 est identique sur SARS-CoV-2 et RaTG13 de chauve-souris

      mfhlvdfqvt iaeilliimr tfkvsiwnld yiinliiknl sksltenkys qldeeqpmei

    • Shawford Chantounette 30 décembre 2020 14:10

      ALERTE P4

      Cyrus, y’a un clampin qui a besoins d’aide pour troller ASCII genre ! smiley smiley smiley ❤️

      💊🧠🦠


    • Adèle Coupechoux 30 décembre 2020 15:44

      @Bendidon

      En fait, s’il se propage aussi vite, ou du moins si nous savons qu’il se propage vite, c’est que nous avons mis en place des tests. Des tests pour un simple nez morveux, une toux, une fatigue passagère, et aussi sans aucun symptôme... smiley

      Alors que pour la grippe, nous n’avons jamais eu de test, à ma connaissance. En tout, cas je n’ai jamais fait de tests quand j’attrapais un rhume, une bronchite, une grippe. Un diagnostic était suffisant avant le COVID...
      Et même quand une trachéite m’a clouée au lit. Un simple examen du médecin, pas de test....


  • pierrot pierrot 30 décembre 2020 11:10

    Les pandémies sont des évènements récurrents (voir grippes), peste, choléra, Ebola...

    Le virus a besoin d’un hôte qui peut être une chauffe souris, un animal domestique, un oiseau ...

    Elles sont vaincues soit par l’isolément des populations infectées, mais actuellement plus souvent par des molécules thérapeutiques et par des vaccins qui ont fait la preuve de leur grande efficacité (polio...).

    Les vaccins ARN messager apportent une grande efficacité, faciles à fabriquer à cout de revient faible et quasi sans effet secondaire significatif.


    • Francis, agnotologue Francis 30 décembre 2020 11:32

      @pierrot
       
       bravo pour la publicité. Gratuite ? Pfff ! Que ne feraient as les petits actionnaires pour gagner quelques petits sous ... ou ne pas en perdre !
       

       


    • roby roby 30 décembre 2020 12:09

      @pierrot
      « La chauffe souris »je ne connaît pas par contre je connais chauffe Marcel


  • Taverne Taverne 30 décembre 2020 12:00

    L’avenir sera-t-il de former plus de vétérinaires que de médecins ? En effet, s’il faut surveiller toutes les bestioles...


  • phan 30 décembre 2020 12:20
    L’antivirus (Doliprane + le 15 au cas où) est le remède de l’année (approuvé par le Cnom) !

  • Bernard Dugué Bernard Dugué 30 décembre 2020 12:30

    Matsuyama, T., Kubli, S.P., Yoshinaga, S.K. et al. An aberrant STAT pathway is central to COVID-19. Cell Death Differ. 2020 27, 3209–3225. https://doi.org/10.1038/s41418-020-00633-7

    Le COVID-19 est causé par une infection par le SRAS-CoV-2 et se caractérise par divers symptômes cliniques. La production d’interféron de type I (IFN-I) est altérée et les cas graves conduisent au SDRA et à une coagulopathie généralisée. Nous proposons que la physiopathologie du COVID-19 soit initiée par les produits du gène SARS-CoV-2, les protéines NSP1 et ORF6, conduisant à une cascade catastrophique d’échecs. Ces composants viraux induisent un transducteur de signal et un activateur de dysfonctionnement de la transcription 1 (STAT1) et une hyperactivation compensatrice de STAT3. Dans les cellules infectées par le SRAS-CoV-2, une boucle de rétroaction positive établie entre STAT3 et l’inhibiteur de l’activateur du plasminogène-1 (PAI-1) peut conduire à un cycle croissant d’activation en commun avec les réseaux de signalisation interdépendants affectés par COVID-19. Plus précisément, la régulation positive de PAI-1 conduit à une coagulopathie caractérisée par des thrombus intravasculaires. Le PAI-1 surproduit se lie au TLR4 sur les macrophages, induisant la sécrétion de cytokines et chimiokines pro-inflammatoires. Le recrutement et l’activation ultérieure de cellules immunitaires innées dans un poumon infecté entraîne la destruction de l’architecture pulmonaire, ce qui conduit à l’infection des cellules endothéliales régionales et produit un environnement hypoxique qui stimule davantage la production de PAI-1. Une lésion pulmonaire aiguë active également l’EGFR et conduit à la phosphorylation de STAT3. Les autopsies des patients atteints de COVID-19 présentent fréquemment des lésions alvéolaires diffuses (DAD) et une production accrue de hyaluronane (HA), ce qui conduit également à des niveaux plus élevés de PAI-1. Les facteurs de risque de COVID-19 sont compatibles avec ce scénario, car les niveaux de PAI-1 sont augmentés dans l’hypertension, l’obésité, le diabète, les maladies cardiovasculaires et la vieillesse. Nous discutons de la possibilité d’utiliser divers médicaments approuvés, ou des médicaments actuellement en développement clinique pour traiter le COVID-19. Cette perspective suggère d’améliorer l’activité STAT1 et / ou d’inhiber les fonctions STAT3 pour le traitement COVID-19. Cela pourrait faire dérailler le cycle STAT3 / PAI-1 croissant au centre du COVID-19.


  • Géronimo howakhan Géronimo howakhan 30 décembre 2020 13:34

    La personnalité des 13 000 dernières années, le Darth Vader d’or des guerres de l’étoile, est décerné : aux humains !! dans leur globalité sauf exceptions, pour l’ensemble démoniaque et mauvais de leurs œuvres, mais avec des machines....avec mention du mérite agricole boucher, pour être constant dans sa bêtise, encore plus les pseudo génies que les autres, sa barbarie, ses meurtres de masse entre amis, ses tortures, ses destructions de villes, de cultures, de pays, enfin etc la liste est longue.

    Là nous sommes partis pour faire encore mieux...tous vers le suicide, car tout est préférable à la coopération , au partage, à l’équité et bien plus entre tous et ceci volontairement, car alors ce serait la paix donc l’équité or moi je veux plus car j’ai peur de mourir..peur de mourir = refus de mourir=folie = schizophrénie = grandes souffrances et non sens...sauf de posséder et de se mettre soi même sur la plus haute marche d’un podium imaginaire, celui de ma démence.

    La masse, donc chacun, sauf exceptions de moments et de personnes, va continuer à ne voir que son trou du cul à lui, et celui des autres si je peux l’utiliser..donc va continuer après avoir créé ce maître dément issu de la masse bien sur par son choix délibéré totalement incompris de la magie noire de la compétition qui élimine et de société verticale financière qui écrase , cette masse pseudo élites incluses va continuer à soutenir ce maître devenu encore plus fou au delà du possible une fois de plus.

    Elle (donc je) va continuer à croire sans savoir, elle ( donc nous) va continuer à haïr les autres pour sa souffrance auto infligée , enfin etc la liste est si longue.

    Que dire d’autres d’un tel désastre.....le voir il faut, et là il se voit, certains le voient depuis longtemps, au travers de siècles comme il y a 300, 200, 100,50,10, ans nous fumes prévenus mais que faire contre une telle volonté de suicide n’est il pas ??

    donc il faut le vivre ce fait de notre démence sans rien faire, alors il va parler, si si, mais cela ne viendra plus de l’analyse, ni donc bien sur de l’intellect, donc pas de la pensée ni de la science qui est bien sur partie intégrante du probleme et si ceci est fait sans jugement peut jaillir une Lumière, celle de L’Origine qui ne peut qu’être immortelle, non née etc et surtout inconnue des humains sauf visions involontaires, que la science qui se veut absolu car la science n’est rien que la pensée humaine qui déraille, et bien elle n’aura jamais accés à cette lumière d’où sa névrose suicidaire de nier tout ceci !!

    Bien sur je ne parle pas de la lumière éteinte des pseudo lumières aussi arrogantes et maléfiques que leur créateurs, arrogance n’est elle pas n’est ce pas toujours celle du crétin bouffi d’orgueil, bien sur les deux sont associés pour toujours, genre chercher l’orgueilleux vous trouverez le crétin, est il des alpes ou pas, ..et cette lumière ne viendra pas par les pseudo génies ni les premiers de la classe, non pas que je le veuille ainsi mais c’est ainsi car heureux les pauvres en intrelelct, le royaume des cieux leur appartient, mais par ceux qui sont encore en vie et qui sont en marge de toute cette pourriture. Ceci est potentiellement le chemin de la vie pour tous, le seul réel libre arbitre que nous aurions peut être est alors de vivre ou de refuser la vie car naître = mourir..et c’est précisément ce que nous faisons, nous refusons la vie..le reste ma fois n’est que déclinaison de cela.

    Mais le refus de la mort n’est pas du tout la fin du chemin vers l’origine du désastre auto administré comme cette raclée. Mais l’étape là est l’écroulement...avançons doucement genre deux pas en avant et trois pas en arrière...

    bon j’ai faim..


  • JMBerniolles 30 décembre 2020 14:38

    Bien que ce soit un sujet tabou et parce que c’est un sujet tabou, il faut être clair sur l’origine du Sars-CoV’2./ C’est un produit de Labo

    C’est d’ailleurs ce qui est suggéré dans l’article.

    La piste purement animale s’est complètement effacée.

    1. on n’a pas trouvé l’animal qui aurait porté ce nouveau coronavirus à l’origine. Or il serait obligatoirement proche de l’humain.
    2. le Sars-CoV-2 est spécifiquement surtout très bien adapté à l’homme. Et ce qui est la cause de cette propriété, c’est précisément l’ajout limité par rapport à un virus de Chauve souris, on fait souvent référence au virus de 2013 RaTG13, la protéine Spike, sa Furine ....  

    De nombreux éléments montrent qu’il est possible de créer ce virus en laboratoire par manipulations génétiques. 


    • Adèle Coupechoux 30 décembre 2020 15:48

      @JMBerniolles

      Vu le niveau actuel de la médecine, je peine à croire qu’ils aient été capables de créer un virus. smiley


    • JMBerniolles 30 décembre 2020 16:12

      @Adèle Coupechoux

      Cela concerne la Biologie

      La médecine a encore un très bon niveau en France parce que la chaine de transmission du savoir n’a pas été interrompue. Maintenant nous sommes en train de vivre une intrusion de la politique dans ce domaine scientifique. Avec également la promotion d’incompétents. Ainsi que la corruption.
      Dans l’enseignement il y a aussi la destruction de l’enseignement des maths et des sciences...  Donc les perspectives ne sont pas bonnes.


    • Adèle Coupechoux 30 décembre 2020 17:43

      @JMBerniolles

      Le syndicat SUD SU a alerté sur cette dérive qui touche la liberté d’enseignement : 

       « Libres, mais pas trop

       La loi Savary de 1984 avait institué clairement les libertés académiques en introduisant l’article L952-2 du Code de l’Education : « Les enseignants-chercheurs, les enseignants et les chercheurs jouissent d’une pleine indépendance et d’une entière liberté d’expression dans l’exercice de leurs fonctions d’enseignement et de leurs activités de recherche, sous les réserves que leur imposent, conformément aux traditions universitaires et aux dispositions du présent code, les principes de tolérance et d’objectivité. ».

       L’amendement 234, proposé par la sénatrice LR de l’Essonne Mme Laure Darcos(**), ajoute la mention « Les libertés académiques s’exercent dans le respect des valeurs de la République »Par ces termes en apparence inoffensifs, la loi donnerait toute latitude à l’administration ou au pouvoir politique pour sanctionner un.e universitaire dont les propos leur déplairaient. En effet, l’expression « le respect des valeurs de la République » est suffisamment vague et indéfinie pour que la loi puisse inquiéter non seulement un.e universitaire tenant des propos argumentés mais peu orthodoxes sur la laïcité (ce qui est déjà inquiétant en soi), mais aussi tout.e universitaire critiquant publiquement des choix politiques « régaliens ». Ce coup de canif dans la liberté de parole des universitaires s’élargira à coup sûr pour contrôler aussi leurs prises de position sur des sujets scientifiques sensibles pour le pouvoir, comme les questions sanitaires, la gestion des risques industriels, etc. Dans le domaine des sciences politiques et économiques, un tel contrôle du pouvoir sur les travaux universitaires signifierait la disparition à moyen terme des politologues et économistes hétérodoxes, et la fin de la pluralité dans ces enseignements. A plus long terme, potentiellement, l’enjeu est donc la fin de la pluralité des expressions politiques et économiques dans le débat public, au seul profit de la pensée dominante. »

      La médecine sera aussi touchée par la pensée dominante qui s’installe en ce moment et est désastreuse pour notre santé.


    • Bernard Dugué Bernard Dugué 30 décembre 2020 20:21

      @JMBerniolles
      L’article ne privilégie pas la piste du laboratoire, vous n’avez pas lu mon article ou vous l’avez interprété de travers. 
      Sinon, un laboratoire peut fabriquer sans souci un génome ARN de corona, ce n’est pas pour autant qu’il trouvera la bonne formule. La nature est bien plus efficace dans la production de virus


    • JMBerniolles 30 décembre 2020 21:59

      @Bernard Dugué

      Je respecte vos connaissances et vos articles sont intéressants.
      Mais il y a un moment où il faut répondre aux questions essentielles.

      L’origine du Sars-CoV-2 est une question majeure. Je pense que l’on a les éléments pour affirmer que ce virus extrêmement virulent parce qu’il est adapté à l’humain est une création de Laboratoire. Je n’ai pas dit que vous disiez cela, mais que cela était suggéré dans votre article.

      Si vous voyez une origine naturelle alors il serait intéressant que vous décriviez le processus global qui part naturellement d’un virus de Chauve souris.et aboutit au Sars-CoV-2. Et si ces mutations s’étaient produites dans un animal pour quelles raisons ne l’a-t-on pas identifié aujourd’hui ?

      J’ai proposé un article sur ce site examinant la possibilité d’une origine naturelle de ce nouveau coronavirus passant par un dernier stade de mutations dans l’humain même. C’est une possibilité qui a été étudiée évidemment. L’article a été censuré.

      Le fait que le Sars-CoV-2 soit une création de laboratoire ouvre un champ de questions dérangeantes que le système veut éviter à tout prix.

      Le documentaire Hold up accuse à tort à mon avis le Laboratoire Pasteur, mais il n’en reste pas moins que ce laboratoire a déposé un brevet européen, il y a déjà un certain temps, sur la création d’un virus s’apparentant de près au Sars-CoV-2. Je pense que c’était dans l’optique d’un vaccin. Mais il y avait déjà l’idée de la manière dont un virus animal de Chauve souris peut finir par infecter l’humain.


    • Bernard Dugué Bernard Dugué 31 décembre 2020 13:31

      @JMBerniolles Le brevet Pasteur n’a rien à voir avec le CoV de 2019
      Des séquences importantes sont conservées, sur RaTG13 et Pangolin de 2020
      GenBank : QIG55949.1

      Tout se joue sur cette insertion du code furine. Seul un expert en recombinaison et mutations des coronas peut savoir si cette insert est naturel ou bricolé
      C’est ici que ça se passe

      661 ecdipigagicasyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnftisv

      692 ecdipigagicasyqtqtnsrsvasq  siilaytmslgaensvaysnnsiaiptnftisvt

      656 ecdipigagicasyqtqtnsrsvssq aiiaytmslgaensvayannsiaiptnftisv


    • JMBerniolles 31 décembre 2020 15:19

      @Bernard Dugué

      Merci pour votre réponse.

      Dans le Brevet déposé au niveau européen en 2004 par l’Institut Pasteur qui est relatif à une invention réalisée sur un coronavirus de type Sars trouvé à Hanoï dont le but énoncé est notamment un vaccin, on lit ceci :

      [0004] Protein S is a membrane glycoprotein (200-220 kDa) that is in the form of spikes or « spike » emerging from the surface of the viral envelope. It is responsible for the attachment of the virus to the receptors of the host cell and the induction of viral envelope fusion with the cell membrane.

      Il y a là incontestablement l’architecture du Sars-CoV’2.  

      L’Institut Pasteur ne l’a pas créé, cela me parait clair. Il provient d’un autre Labo et naturellement les Labos de Wuhan sont en première ligne. Ils sont d’ailleurs explicitement accusés par des biologistes chinois dissidents. 


  • Clocel Clocel 30 décembre 2020 18:42

    Robert Kennedy Jr à propos du vaccin.


  • Jean Keim Jean Keim 31 décembre 2020 08:03

    Vous avez achevé votre intéressant article par cette sentence : « Le 21ème siècle sera celui de la pensée, sinon, il ne sera qu’un naufrage ! »

    Pourtant 100 % des êtres humains pensent, il suffit de lire de lire ou d’écouter les médias pour s’en rendre compte, alors à quelle forme de pensée faites-vous allusion et sur quoi cette forme de pensée doit-elle s’appuyer, contrairement à une autre forme de pensée qui, si je vous suis bien, serait ordinaire voire triviale ?


  • Zolko Zolko 31 décembre 2020 18:03

     SARS-CoV-2

     

    c’est dans le titre : ...-2 ! -2 !!! C’est le deuxième SARS, le premier était en 2003, il s’agit donc d’un sequel, une suite du premier épisode. Et encore, on oublie qu’en fait il s’agit du -3, car il y avait déjà le MERS de 2014 qui était aussi causé par un coronavirus.

     

    Désolé Bernard, mais à force de vouloir justifier scientifiquement une telle supercherie, vous devenez l’idiot utile qui ne voit pas la forêt caché derrière l’arbre. Le Covid-19 est une arnaque, et vous tombez dedans avec les 2 pieds.

     

    Pourquoi ne feriez-vous pas un article qui comparerait les 3 SARS causés par des coronavirus : SARS de 2003, MERS de 2014, et SARS-2 de 2020 ? Qu’on rigole un peu. Là vous deviendriez scientifiquement significatif.


  • Christian proctoconspirologue Christian 1er janvier 22:58

    @bernard

    Un article « pépite », en cadeau spécial pour cette nouvelle année, qui espérons la viendra, comme celle qui vient de finir, laisser entendre autant les dissonances génératives que les résonances alignantes des 3 plans dense/moyen/léger, qui constituent notre permaculture énergétique psychique, comme l’article l’explique.

    https://resonancepath.com/evolution-toward-wholeness/


Réagir