dimanche 20 décembre 2020 - par Bernard Dugué

Mutation du virus à Londres, faut-il redouter un SARS-CoV-3 ? Le conseil de défense s’est réuni

PNG

 Crédit photo : Wikimedia Commons

 1) Un an après les premiers cas de Covid détectés à Wuhan, les autorités britanniques nous alertent sur ce qui est présenté comme un variant, une lignée, une souche du SARS-CoV-2. L’affolement des gouvernements et des médias laissent penser que le Londres de décembre 2020 ressemble au Wuhan de janvier 2020 ; et donc qu’il faut déclarer Londres zone interdite en annulant les vols depuis cette destination, puis en supprimant les trains. Un conseil de défense s’est même réuni à l’Elysée ce dimanche à 17 heures, avec le président en visioconférence. Quelques mutations sur un petit génome produisent un effet sismique sur les gouvernements, c’est ce qu’on appelle l’effet papillon.

 Est-ce un nouveau virus ou un variant plus agressif ? Les autorités affirment que ce variant serait plus contagieux mais pas plus dangereux sur le plan clinique et qu’il n’impacterait pas la vaccination. Autrement dit, ce virus circule plus vite et c’est ce qui inquiète les autorités car la stratégie sanitaire consiste à contenir la propagation du virus. Ce n’est pas la meilleure stratégie mais c’est celle qui est choisie et forcément, si un variant s’avère plus contagieux, cela est très ennuyeux. Faut-il s’inquiéter de la propagation de ce nouveau variant ? Pour répondre à cette interrogation, il est recommandé de se baser sur les éléments scientifiques établis par les virologues. Une étude préliminaire a été publiée le 19 décembre. Nous avons accès aux différentes modifications de ce variant et nous savons qu’il a circulé depuis un mois au Royaume-Uni, non seulement à Londres mais aussi en Ecosse et au Pays de Galles, plus quatre autres pays qui ne sont pas cités par les auteurs de cette étude.

 

 2) Le nouveau variant a subi 23 mutations nucléotidiques sur une séquence de 30 000 bases, ce qui représente moins de 0.1% de divergence par rapport au virus de Wuhan séquencé en janvier. Le chiffre de 24 n’a rien d’exceptionnel. Les variants circulant actuellement ont accumulé 10 à 15 mutations en moyenne. Sur les 24 mutations du nouveau variant, 17 sont non synonymes et produisent un changement sur une des protéines virales. Le nombre de substitution d’acides aminés est colossal, plus de 30 000 sont enregistrées. Rien que pour la protéine S, quelque 5000 substitutions ont été répertoriées. La plupart des mutations sont sans incidence sauf celles qui ont une incidence aurait dit Monsieur de la Palice. Les virologues surveillent de près les mutations sur la protéine Spike, devenue pratiquement une sorte de totem en covidologie. C’est par cette protéine formant une protubérance sur l’enveloppe que le virus entre dans la cellule pour l’infecter. Le nouveau variant présente 8 mutations sur S dont deux sont prises au sérieux par les virologues

 

 3) La protéine S du nouveau variant possède deux délétions mineures sur la partie N-terminale de S1, deux substitutions sur la sous-unité S2 côté C-terminal, une sur la sous-unité S1 côté C-terminal. Il reste deux substitutions sur le domaine RBD de liaison au récepteur ACE2, ce qui n’a rien d’étonnant car ce domaine est connu pour sa variabilité, contrairement à d’autres domaines et notamment le domaine de fusion FP situé sur la sous-unité S2 qui est extrêmement conservé. Les deux substitutions sur RBD ont comme nom de code N501Y et A570D. La mutation 501 aurait une incidence sur la liaison de la protéine, augmentant son affinité assortie d’une contagiosité observée sur des modèles animaux. Il reste la mutation P681H qui n’a rien d’anodin car elle se situe sur le site de clivage de la furine. Les deux mutations sensibles, 501 et 681 n’ont rien de récent, elles ont été observées depuis des mois. La 501 a circulé en Australie dans la région de Melbourne ; elle a été repéré au Brésil, dans quelques localités américaines ; elle n’indique pas spécialement une contagiosité exceptionnelle ; si tel était le cas, elle se serait répandue massivement. La 681 a été observée aux Baléares au début du printemps 2020, au Japon, puis elle s’est légèrement répandue en Inde et aux Etats-Unis pendant l’été et pour finir, au Royaume-Uni ce dernier mois. En fait, ce n’est pas chaque mutation qui inquiète les virologues mais la combinaison de ces deux mutations qui elle, est assez récente. Sans oublier les 15 autres mutations qui interpellent plus par leur nombre que par une réelle incidence sur la reproduction des virions. 

 

 4) Pour pénétrer dans une cellule hôte, le virion SARS-CoV-2 se lie sur le récepteur ACE2 puis doit fusionner avec la membrane pour basculer de l’autre côté. Il dispose de deux codes, furine et trypsine. C’est ce qui explique l’impact de cet agent infectieux ayant causé la pandémie de 2020. Il est pratiquement établi que le code furine est responsable de l’infection respiratoire supérieure, ce qui rend le virus très contagieux, alors que le code trypsine permet l’entrer dans l’épithélium pulmonaire, ce qui rend le virus très méchant. Le SARS de 2002 n’avait pas ce code furine ce qui explique la faible contagiosité et la maîtrise de cette épidémie. Le code trypsine est conservé sur la lignée des sarbecovirus occupant le réservoir chauves-souris, pangolins, civettes et depuis 2002 l’homme. Le code trypsine s’écrit skpskrs, il est suivi d’un peptide de fusion (fiedllfnkvtladagfikqygdc) conservé sur les coronavirus. Ce code figure sur des virus de chauve-souris et de pangolins. Il existe aussi dans le réservoir de 2002 incluant la civette mais avec cette variante skptskrs. C’est en quelque sorte la marque de fabrique des sarbecovirus où figurent les deux souches ayant causé quelques ennuis à l’homme. Voici le code trypsine situé sur la sous-unité S2 et qui dont le clivage est désigné comme S2’ :

 

801 nfsqilpdpskpskr↓sfiedllfnkvtladagfikqygdclgdiaardlicaqkfngltv

 

 En revanche, le code furine est assez énigmatique car on ne sait pas d’où il vient. Il est propre au SARS-CoV-2 et ne figure ni sur le SARS de 2002 ni sur les souches récupérées sur le pangolin ou la chauve-souris, comme la ZC41, la ZXC21 et la RaTG13 qui est la plus proche en homologie, sans oublier la Rc-0319 récupéré en 2013 au Japon et dont le séquençage vient d’être publié. Voici le code furine dont le clivage est désigné S1/S2 :

 

661 ecdipigagicasyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnfti

 

 La substitution P681H modifie légèrement le code furine, sprrars devient shrrars. Cette mutation ne modifie pas le motif polybasique à arginine servant de code. Et qui une fois le clivage effectué, pourrait se fixer sur la neuropiline (C-end rule) et influencer l’entrée du virus (quelques résultats ont été publiés mais j’ignore si ce détail a une importance en épidémiologie, ni si quelques effets cliniques en découlent)

 

 5) La combinaison des mutations 501 et 681 n’a aucune raison de rendre le virus plus contagieux, autrement dit, d’augmenter significativement la reproduction des virions dans les tissus respiratoires. Pas plus qu’elle laisse penser à une plus grande dangerosité (qui du reste, est liée au site trypsine pour l’essentiel, sans oublier les mécanismes viraux permettant aux protéines virales de hacker les codes de la cellule hôte et de détourner son système de traduction tout en neutralisant les défenses immunitaires). Les autres mutations portent sur les protéines non structurales codées par la séquence ORF1ab. Deux mutations sont observées sur la protéine N mais ne devraient pas avoir d’incidence. La S235F substitue une sérine et aurait une incidence si elle modifiait une éventuelle phosphorylation. Restent les mutations sur la protéine codée par ORF 8 ; notamment celle qui porte sur le codon stop en 27 et qui conduit à une perte de fonction, autrement dit, une tendance à perdre en efficacité.

 Pourquoi ce variant s’est-il répandu si vite ? L’explication n’est pas forcément virologique. Il se peut très bien que ce variant se soit propagé entre personnes rassemblées en nombre lors d’une réunion ou une fête, ce qui a favorisé la propagation. Souvenez-vous du rassemblement évangéliste à Mulhouse. Un mégacluster s’est formé et le virus s’est répandu à une vitesse phénoménale en Alsace, se propageant ensuite dans d’autres lieux. C’est certainement par excès de précaution que le rapport préconise une surveillance internationale de ce variant qui accumule un nombre de mutations au-dessus de la moyenne, mais sans que cela ne justifie d’invoquer une nouvelle souche. Seule une recombinaison décisive pourrait créer une souche inédite. La nouvelle souche ressemble bien à une fiction médiatique. C’est une souche infodémique, qui s’est répandue sur tous les médias de masse. Cela dit, la prudence incline à ne pas tirer de conclusion définitive. Ce nouveau variant est au final une aubaine pour les réalisateurs collaboratifs de la série Covid, saison 2, prévue pour 2021.

Publicité

 

Bernard Dugué, PhD, covidologue

 

 

 Etude préliminaire sur le variant de Londres

 

https://virological.org/t/preliminary-genomic-characterisation-of-an-emergent-sars-cov-2-lineage-in-the-uk-defined-by-a-novel-set-of-spike-mutations/563

 

 Traduction automatique de quelques extraits

 

 Caractérisation génomique préliminaire d'une lignée émergente du SRAS-CoV-2 au Royaume-Uni définie par un nouvel ensemble de mutations de Spike

 

 Report written by : Andrew Rambaut, Nick Loman, Oliver Pybus, Wendy Barclay, Jeff Barrett, Alesandro Carabelli, Tom Connor, Tom Peacock, David L Robertson, Erik Volz, on behalf of COVID-19 Genomics Consortium UK (CoG-UK)9.

 

University of Edinburgh

University of Birmingham

University of Oxford

Imperial College London

Wellcome Trust Sanger Institute

University of Cambridge

Cardiff University

Publicité

MRC-University of Glasgow Centre for Virus Research

https://www.cogconsortium.uk 332

 

 

Résumé

Récemment, un cluster phylogénétique distinct (nommé lignée B.1.1.7) a été détecté dans l'ensemble de données de surveillance COG-UK. Cette grappe a connu une croissance rapide au cours des 4 dernières semaines et a depuis été observée dans d'autres localités du Royaume-Uni, indiquant une propagation supplémentaire.

 

Plusieurs aspects de ce groupe méritent d'être soulignés pour des raisons épidémiologiques et biologiques et nous rapportons les résultats préliminaires ci-dessous. En résumé :

la lignée B.1.1.7 représente une proportion croissante de cas dans certaines parties de l'Angleterre. Le nombre de cas B.1.1.7 et le nombre de régions signalant des infections B.1.1.7 sont en augmentation.

B.1.1.7 présente un nombre inhabituellement élevé de modifications génétiques, en particulier dans la protéine de pointe.

Trois de ces mutations ont des effets biologiques potentiels qui ont été décrits précédemment à des degrés divers :

 

La mutation N501Y est l'un des six résidus de contact clés dans le domaine de liaison au récepteur (RBD) et a été identifiée comme une affinité de liaison croissante avec l'ACE2 humaine et murine.

La délétion de pointe 69-70del a été décrite dans le contexte de l'évasion de la réponse immunitaire humaine mais s'est également produite un certain nombre de fois en association avec d'autres changements de RBD.

La mutation P681H est immédiatement adjacente au site de clivage de la furine, un emplacement connu d'importance biologique.

La croissance rapide de cette lignée indique la nécessité de renforcer la surveillance génomique et épidémiologique dans le monde entier et d'enquêter en laboratoire sur l'antigénicité et l'infectiosité.

 

Conclusion

Nous rapportons une lignée à croissance rapide au Royaume-Uni associée à un nombre étonnamment élevé de changements génétiques, y compris dans le domaine de liaison au récepteur et associés au site de clivage de la furine. Compte tenu (i) des conséquences phénotypiques plausibles et prédites expérimentalement de certaines de ces mutations, (ii) de leurs effets inconnus lorsqu'ils sont présents en combinaison, et (iii) du taux de croissance élevé de B.1.1.7 au Royaume-Uni, cette nouvelle lignée nécessite une caractérisation urgente en laboratoire et une surveillance génomique renforcée dans le monde entier.

 



42 réactions


  • Géronimo howakhan Géronimo howakhan 20 décembre 2020 18:14

     


    • Bendidon Bendidon 20 décembre 2020 19:57

      @Géronimo howakhan
      Alors comme chat les vilains conspis avaient raison d’affirmer qu’un COVID 21 était dans les tuyaux
      Ché un cadeau du Père NOEL alors smiley


    • Nicolas Cavaliere Nicolas Cavaliere 20 décembre 2020 20:19

      @Bendidon

      Le COVID est un épiphénomène. C’est un sujet qu’il faudrait délaisser. Pendant que tout le monde a les yeux braqués sur un virus microscopique (par définition, on ne peut pas le voir à l’œil nu), il y a des ordonnances qui passent, et elles ne relèvent pas de la médecine, mais de l’organisation de la vie du pays. C’est par là que les investigations sont nécessaires.


    • Le Panda Le Panda 20 décembre 2020 20:46

      @Bendidon, Allez merci 
      Prends connaissance de mes post, et tu ne montrera plus du doigt ! Chalut Toi  smiley

      Le Panda


    • Le Panda Le Panda 20 décembre 2020 20:49

      @Bendidon
      Chalut toi, je ne suis pas le Père Noël, sauf pour mes petits enfants merci de prendre connaissance de mes deux post et en riras  smiley Le Panda


    • Sylv1 20 décembre 2020 22:05

      @Nicolas Cavaliere
      Bah on est en train de tout péter au niveau économique et social, et le monde a juste peur d’un virus qui tue moins de 0,5%.
      Et là on va nous refaire des prédictions apocalyptiques et c’est reparti pour un tour. Pauvres humains.


    • Géronimo howakhan Géronimo howakhan 21 décembre 2020 10:50

      @Bendidon

      Salut, j’attends encore le premier...qui soit autre chose que ce qui se passe depuis des millions d’années...
      cela dit ce coup d’état mondialiste, pour rester légal, a redémarré, c’est pas la première tentative, vers le siècle des lumières en France mais pas seulement bien sur. fausses révolutions 1789, 1917, guerres, enfin etc

      On peu comprendre que ceux qui se croient héritiers de cela essayent de finir leur projet, merde 3 siècles de boulot pour ce dernier projet mais pour rien ça serait dommage.
      Mais la masse est là pour les aider, ouf !! j’ai eu peur.. il est interdit de parler et mème interdit d’évoquer tout ce qui s’y rattache, désignant par là même les coupables principaux qui donc s’assument comme tel mais pas ouvertement, un coté « je suis lâche » peut être ? 
      Mais derrière cette apparent simplicité le drame réel est que en fait c’est la masse humaine sauf exceptions de moments et de personnes qui crée elle même et donc permet ce désastre , les mondialistes ne sont que des effets de ce que la masse veut.. ..,ce sont simplement les gagnants de la compétition pour avoir plus car j’ai peur de tout, gain fait par vol sur le dos des autres, jeu joué par nous la masse.

      Cela dit il est normal de se cacher pour le mensonge car il ne supporte pas la lumière, le vrai. etc , le mensonge ne peut survivre comme les Orcs du Seigneur des Anneaux que par la violence et dans le noir..mensonge sous toutes ses formes..

      ils ont un plan, Dieu ou l’Origine, ou l’Univers etc..choisir son mot à soi selon préférences , Dieu a mal fait son travail disent t’ils et il n’est pas fini...nous auto proclamés élites qui tout connement refusons de mourir allons arranger cela, là est une des racines de la démence suicidaire humaine, dommage car souvent c’est le seul absolu de notre pseudo vie et on le rejette car maman on a peur. Genre 3 a 4 ans d’age mental nous avons, pseudo génies inclus bien sur..
      Nous donc élites auto proclamés donc à la fois juges et parties, nous allons changer tout ça, comprendre ne pas mourir, et finir le travail pour nous, car les autres ça va barder pour eux ..on a donc ce cloporte humain, désolé dis je à mes amis cloportes que j’aime bien depuis tout jeune, ce cloporte humain qui attaque de front l’intégralité de l’univers et qui a perdu dès le début bien sur, Univers qui ne peut qu’être absolu, au delà du temps, créateur, non née, immortel, intemporel enfin etc
      c’est déjà pas mal rien que avec cela non ? 
      Ce que je dis là peut être vérifié par tout le monde, par soi même, ne pas me croire sur parole bien sur, et pour cela utiliser à fond une logique simple sans démarrer d’aucune conclusion ni d’aucun désir ..je fais cela souvent depuis très jeune, cela ramène toujours à la même vision.

      Plus con tu meurs ! Mais bon c’est un choix, ah oui le fameux pseudo libre arbitre , genre entre guerre et paix on choisit tous la guerre et on appelle cela compétition car c’est plus jolie, quasiment vendeur, genre TOI TU MÉRITES PLUS CAR TU VEAU MIEUX QUE CES CONS..
      Nous serons bien sur éliminés, quand comment ? je n’en sais rien , mais notre présence ENFIN PSEUDO EXISTENCE ne se justifie plus du tout, car nous refusons la vie pour ce qu’elle est..d’où la souffrance, le suicide, la démence, et oui souffrir et ne rien en savoir donc ne pas résoudre cela rend suicidaire et-ou mauvais, très mauvais..pourquoi ? c’est une façon d’essayer d’oublier ; ah ! ça marche ? pas du tout ! Donc ça s’empire comme dans EMPIRE..oui exact.

      etc ..d’ailleurs c’est en cours l’élimination...ç’est déjà arrivé partiellement, au moins une fois, voir entre autre ici, https://youtu.be/51yMOvBamn0 peu de bonnes vidéo en français la dessus..

      Pourquoi élimination ? Nous ne sommes plus dans l’énergie de la vie tout simplement..une coquille vide nous sommes, ce vide est invivable car il n’est pas supposé être constant or..
      Par contre ça ne date pas d’hier..mais de milliers d’années..
      Si sur le plan extérieur survivre ensemble dans de très bonnes conditions est très facile ce que nous ne voulons pas du tout soyons lucides, facile si et seulement si il y a coopération, partage , équité volontaire enfin etc ce que la masse ne veut pas du tout, même là la masse va mentir elle aussi et prétendre que si, alors que c’est faux..
      Ce changement implique un changement mental avant tout car le mal vient de notre cerveau, enfin de ce qu’il en reste.. cela implique un voyage en soi même, jamais fait depuis des millénaires sauf exceptions.

      Entre autre l’origine du mal humain se trouve dans le refus de la mort, bêtise absolue, qui empêchera l’ouverture de nos autres capacités non acquises, y compris cette autre forme de connaissance illimité qui ne peut être utilisée par la pensée humaine donc pas par la science car pensée analytique = science comme à Hiroshima..,
      Cela ramène notre seule forme de connaissance cumulative et mémorisé, si arrogante et fière d’elle même, perverse et narcissique, comme étant secondaire voir moins car elle ne se transmet pas de manière innée..si si, regardons bien.

      Bêtise immense, qui amène « âne » voir que son trou du cul qui en plus fait mal, donc je me proclame roi de l’univers, Dieu enfin etc car à ce stade de folie où ma vie est souffrance peu importe le mot, des lors auto centré uniquement, les autres sont là pour me servir ou alors je les jette et là le maître qui est là grâce à la masse veut en éliminer un paquet par puer sadisme qui est une forme de plaisir malsain, dément, pervers etc ..ah mais dis donc on dirait les caractéristiques des mondialistes certes bien sur mais aussi de la masse ..dis donc serait il possible que ils soient nous et que nous soyons eux ?? TOUT A FAIT

      Certes c’est pas clair en lecture directe analytique, celle du formatage de l’école, normal cela est fait pour être capté par nos autres capacités non analytiques et je m’en fou mais quand même relativement conscient du probleme mais comme ce genre de propos n’est pas à analyser..


    • V_Parlier V_Parlier 21 décembre 2020 11:22

      @Sylv1
      Et surtout on va laisser la frontière avec le UK bien ouverte (sauf quelques pays réagissent) pour ensuite proclamer une pandémie de cette variante et nous remasquer/confiner pour tout 2021. Ca réglera les problèmes de « troubles » suite à l’écroulement économique.


  • Albert123 20 décembre 2020 18:59

     « covidologue »


    Pourquoi pas après tout, on met bien un vaccin sur le marché (et en grande pompe) en a peine 6 mois alors que toute ma vie on m’a expliqué qu’il fallait 10 ans et avoir recours à de nombreuses études préalables.









  • sylvain sylvain 20 décembre 2020 20:06

    c’est à pleurer de rire


  • jjwaDal jjwaDal 20 décembre 2020 20:10

    Délicat de répondre si on considère que des mutations probablement plus anodines ont rendu 18 patients de l’IHU de Marseille malades deux fois de suite. S’ils ont traité 10 000 malades, c’est une faible proportion mais en même temps si le système immunitaire humain qui a de la bouteille peut se faire rouler dans la farine, a priori un vaccin torché en 6 mois sera pris en défaut tôt ou tard.
    Nature a déjà rapporté le cas d’un patient immunodéficient qui a vu le virus muter deux fois dans son corps en quelques semaines. Donc la bestiole mute assez facilement. Si on doit se planquer sous la table à chaque fois qu’il pète de travers ça va finir par gâcher notre bonheur...


  • binary 20 décembre 2020 20:27

    Un « conseil de défense » qui réunis les personnalités les plus incompétentes possible sur un sujet, qui n est qu un prétexte, afin de camoufler l objectif réel. Objectif qui est attend avant même le début du conseil, puisque, en bonne gestion totalitaire, les décisions précèdent toujours les consultations qui doivent les légitimer, avec force d arguments publicitaires ad hoc, proposés par ces fameux « experts », soigneusement sélectionnés pour leur servilité.

    Conclusion sans surprise : Double dose de vaccin OBLIGATOIRE.


  • Le Panda Le Panda 20 décembre 2020 20:33

    Bonsoir, Bernard Dugué,

    J’avais cessé d’intervenir dans tes articles, la raison est simple. Tu indiques des formules et des causes que le « Lambda ne peut nullement comprendre » Tu aurais pu être bien plus simple. Il est possible que je me trompe, mais je ne le pense pas. Je te conseille si tu le permets, d’indiquer que les virus ont diverses formes et possèdent des failles sur leurs pourtours. Le danger principal sans en connaitre « la gravité » en ces heures, la Covid a mutée et permet par cette mutation de s’accrocher aux particules et de rentrer directement dans les cellules, d’où ’dangers plus rapides« . Pardon, mais si je trouve le schéma de la Covid et la transformation qui s’opère dans la cellule humaine infectée ou pas, je reviendrais te poser le lien, si je le trouve. De ce fait cela sera plus parlant que ce que tu t’évertues depuis quelques mois à expliquer en restant dans le cadre »d’applications fondamentales" sans aucune théories explicables, donc compréhensibles. Toutefois, merci pour le mal que tu tentes de te donner, Bonne soirée, et nous nous côtoyons depuis assez de temps pour que je t’écrive cela.

    Le Panda


    • Le Panda Le Panda 20 décembre 2020 20:44

      @Le Panda
      Bernard, comme promis, j’ai trouvé « une toute partie et je vais te poser le lien de la vidéo » on constate bien que nous sommes loin de tes affirmations, ce que en aucun cas je ne veux prétendre détenir « la vérité sur ce sujet » mais c’est cela de « La prévention » enfin c’est ce que mes « Maitres » m’ont toujours enseignés, merci « Lien » 

      Le Panda


    • binary 20 décembre 2020 20:51

      @Le Panda
      La scientogogologie c est comme le canada dry, ça en a l apparence, le fumet, mais ...


    • Le Panda Le Panda 20 décembre 2020 20:54

      @binary
      bonsoir, 
      merci de cette réaction tout à fait dans le vrai, mais à ce rythme, nous allons rejoindre les « indiens » et nous fumerons le « calumet » de la scientologie fumeuse"..... smiley


    • Bendidon Bendidon 20 décembre 2020 21:01

      @Le Panda
      OUAOUHHHHHH ce soir on s’amuse c’est OPEN BAR
      Avant le grand reset éclatons-nous
      allez la COVID fais péter les roteuses youkoulélé
      mets tes 2 pieds en canard c’est la chenille qui redémarre tatatata
       smiley


  • vraidrapo 20 décembre 2020 20:55

    Le virus est la version « 2.0 » du déluge !

    Que ceux qui ont les moyens s’envoie en l’air chez Elon Must !


  • Sylv1 20 décembre 2020 22:02

    Tiens y’a plus cette histoire de pangolin...

    Hypothèse complotiste (donc hautement probable) : le vaccin anti-grippal injecté ces derniers mois contenait déjà le SARS-COV3. Très malin. Tout comme le SARS-COV2 était dans les vaccin de 2019/2020.


  • SamAgora95 SamAgora95 20 décembre 2020 22:18

    Vous marchez encore dans cette arnaque mondiale du covid ?

    Vous feriez mieux de consacrer votre génie à essayer de comprendre ou le fermier cherche à nous emmener.


  • ribouldingue ribouldingue 21 décembre 2020 01:22

    Et pendant que les européens et les yankees se démènent comme des beaux diables pour faire valoir leur vénérable vaccin, celui qui remplira le premier les poches des laboratoires pharmaceutiques.

    Nos amis les noiches se foutent royalement de nos gueules avec leur sourire engagé en faisant la danse des canards dans les rues, et les boîtes de nuit de wuhan le berceau de l’épidémie.

    Après avoir vérolé le monde entier en se goinfrant de pangolins, de chauves-souris, de rats, de chiens, d’ailerons de requins, de singes afin d’obtenir les meilleures performances de la bandaison. Dutronc chantait en 1966 « et, et moi, 500 millions de chinois » .

    Depuis leur découverte des écailles de pangolins qui les font bander comme des taureaux ils se sont rattrapés en se reproduisant comme des lapins pour atteindre 1,4 milliards en 2020. Qu’ils s’enculent à la fin s’ils ne veulent pas utiliser la contraception.

    Merde ! C’est vrai quoi !

    Non seulement, on ne peut plus rien acheter, puisque comme des cons nous leur avons refilé toutes les industries, nous sommes maintenant obligés de racheter ce que nous leur avons offert gracieusement. Et en cadeau ils nous refilent la vérole.

    Ce n’est plus le péril jaune, c‘est une chaude pisse mondiale.

    C’est l’effet boomerang.

    Comme disait ma grand-mère. Le chinois est fourbe. Quand il te sourit ne prend pas ça pour de la sympathie . Il se fout tout simplement de ta gueule. Pour lui faire comprendre que tu n’es pas plus con que lui. Réponds lui par un sourire.


  • goc goc 21 décembre 2020 04:07

    Merci Bernanrd pour cet article et surtout pour votre volonté à essayer de nous rendre moins c.. que la moyenne, même si dans mon cas c’est plutôt « mission impossible ».

    J’aimerais avoir votre avis concernant l’intervention récente du Pr Raoult, qui nous a expliqué que son labo avait déjà détecté 4 mutations importantes durant ces 9 derniers mois, avec des effets totalement différents, notamment le quatrième qui était à l’origine du 2eme confinement, et qui depuis fin Octobre semble disparaitre doucement. Le nombre d’hospitalisation, de rea et de morts est en constante diminution depuis début Novembre, alors que le nombre de cas positifs est en constante augmentation, mais là on en connait les raisons (qui sont surtout non médicales)


  • Old Dan Old Dan 21 décembre 2020 04:18

    Vos sources semblent sérieuses...

    (Le peu que) j’y connaisse professionnellement, et les quelques inconnues biologiques qu’il reste à lever, ne sommes-nous pas au bord d’un emmerdement maximum qui prendrait de vitesse notre « stratégie vaccinale » actuelle en cours ?...


    • Bernard Dugué Bernard Dugué 21 décembre 2020 11:23

      @Old Dan
      Les problèmes liés à l’antigénicité de Spike sont connus depuis un bon moment
      Ici une étude à prendre avec précaution pour ce qui concerne la contagiosité, observée in vitro. En revanche, les études antigéniques ont un intérêt. J’ignore pourquoi les labos n’ont pas essayé la protéine N qui elle aussi, déclenche une immunité humorale et s’avère plus stable
      https://www.cell.com/action/showPdf?pii=S0092-8674%2820%2930877-1

      En résumé, nous avons analysé plus de 100 virus pseudotypés en termes de leur infectivité et de leur sensibilité à la neutralisation par des Acm bien caractérisés ou des sérums humains de patients convalescents. Des changements d’acides aminés ont été observés dans toute la protéine de pointe. Un changement d’acide aminé (D614G) en dehors de la RBD s’est avéré plus infectieux, mais aucune preuve de résistance aux anticorps neutralisants n’a été démontrée. Cependant, la domination croissante du D614G mérite une attention particulière. Bien que certaines souches avec des changements d’acides aminés à la RBD étudiées ici aient perdu leur infectivité, ce qui suggère qu’elles pourraient ne pas se généraliser, les variantes naturelles de RBD avec une résistance accrue à la neutralisation médiée par des anticorps doivent être étroitement surveillées. De plus, l’ablation des sites de glycosylation affectait leur réactivité aux anticorps neutralisants, ainsi que leur infectivité, renforçant la notion que le glycane pourrait considérablement affecter la réplication virale du SRAS-CoV-2 et les réponses immunitaires induites par le vaccin. Collectivement, nos résultats aident à faire la lumière sur les implications de certaines souches en évolution dans les virus en circulation en ce qui concerne une infectivité accrue et une antigénicité modifiée.


  • samy Levrai samy Levrai 21 décembre 2020 06:02

    « Les autorités affirment que ce variant serait plus contagieux mais pas plus dangereux sur le plan clinique et qu’il n’impacterait pas la vaccination  »

    Pas d’impact sur la vaccination cela veut dire qu’on continuera a l’attraper et à le filer comme avec le variant d’avant ? 


  • nono le simplet nono le simplet 21 décembre 2020 06:41

    Ce nouveau variant est au final une aubaine pour les réalisateurs collaboratifs de la série Covid, saison 2, prévue pour 2021.

    pas pu s’empêcher de lâcher une petite piqure de venin ?

    le plus important reste l’efficacité des vaccins ... pour le reste, s’il s’avère que cette souche est réellement plus contagieuse, les prévisions qui étaient dèjà mauvaises vont passer de pire à encore pire ...


  • alanhorus alanhorus 21 décembre 2020 11:26

    Il est surprenant que la mutation soit arrivé en Angleterre pays ou fut créer l’institut tavistock.

    Cet institut est avant tout pour controller les masses par la propagande, par exemple c’est une personne de cet institut edward bernays qui obligeat les femmes à fumer en utilisant la publicité des sufragettes c’est aussi cet institut qui creat le mouvement hippies la beatlemania mais surtout les guerres mondiales la deuxieme et celle en irak avec la fameuse histoire des couveuses du koweit.

    https://www.youtube.com/watch?v=S6LlrtmZUL0

    L’INSTITUT TAVISTOCK // le Secret Le Mieux Gardé d’Amérique

    Orwell et Huxley ont aussi collabore avec Tavistock. sigmund freud hitler etc

    https://www.youtube.com/watch?v=D0jVxY9ziLs&t=519s

    Hitler, Stalin, Mao, Rothschild, and British Royal Family Connections

    Je copie ici un commentaire sur les vaccins :

    Les quelques rares parents que je connais (pas en France) qui n’ont pas vaccine leurs enfants, tous m’ont partage que leurs enfants, maintenant ados, ne sont jamais malades. TOUS les parents que je connais qui ont vaccine leurs enfants, TOUS leurs enfants ont : eczema, allergies, anaphylaxie, asthme, quelquefois plusieurs de ces trucs. Et je parle d’enfants de moins de 2 ans ici. Donc difficile d’accuser autre chose que les vaccins.

    Parmi les premieres victimes du vaccin contre le covid, plusieurs ont developpe un « bell’s palsy ». Cherchez sur duck duck go images, c’est une paralysie faciale qui te donne l’air vraiment con. Et c’est permanent, donc t’as l’air con en permanence.

    Des rapports disent que ce vaccin ARNm affecte une certaine proteine qui va rendre les femmes infertiles.

    Beaucoup de docteurs disent qu’il va y avoir une hecatombe de cas de maladies auto-immunes.

    Mieux vaut prevenir que guerir. Pourquoi prendre le risque ? Si on te fait un chantage a l’emploi, et si tu developpes une maladie auto-immune, tu te feras virer de toute facon, car plus capable physiquement d’exercer ton travail. Ta vie est fouttue a ce stade.

    Revoyez la theorie de Antoine Bechamp. Une bonne alimentation (80% de fruits et legumes frais), de l’eau, pas d’alcool, pas de tabac, un bon sommeil, un peu d’exercice regulier, et tu petes la sante, les virus ne peuvent pas se developper dans ton corps au point de te tuer, ni meme au point de te rendre tres malade. Ca vaut pour le covid 19, et les futurs covid, covid 21, covid quarante douze, covid 6 millions.

    Courage a tous !

    Avec l’histoire du vaccin covid et tout le reste masques test pcr confinement nous vivons dans une manipulation de type tavistock dont les buts sont mauvais et inhumains.


  • pierrot pierrot 21 décembre 2020 11:29

    Article intéressant et assez bien documenté.

    Cependant globalement, nous observons que le coronavirus mute très peu, car les 24 mutations nucléotidiques ne représentent que 0,1 %de divergence.

    Il est donc hautement plausible que cela n’aura aucun impact sur l’efficacité des vaccins à ARN, mais restons vigilants et attendons des compléments d’informations des experts virologues..


  • Hervé Hum Hervé Hum 21 décembre 2020 11:39

    la seule manière, à mon sens, pour qu’un variant soit plus contagieux, c’est qu’il ait besoin d’une charge virale moins importante, sans cela, je ne vois pas comment il pourrait être plus contagieux.


  • phan 21 décembre 2020 13:22
    Mutation du virus à Londres et mutation de la chloroquine à Paris, inoffensive pendant 70 ans, voilà qu’elle est devenue dangereuse.

  • xana 21 décembre 2020 13:34

    Une question et une seule :

    Pouvez-vous d’ores et déjà nous dire clairement si les vaccins qu’on se prépare à nous inoculer auront la moindre chance de nous protéger contre ces mutations ?


  • Zolko Zolko 21 décembre 2020 14:03

    @l’auteur : excusez-moi, mais vous n’avez rien compris : pourquoi pensez-vous qu’ils ont appelé ça « Covid-19 » ? C’est un coup de marketing pour pouvoir sortir le Covid-20, -21, -22 ... Je me demande simplement à partir de quel numéro les rigolos de votre genre vont se rendre compte que tout-ça c’est du flan.


  • scorpius scorpius 21 décembre 2020 14:15

    La mutation s’appelle juste « no deal » et vous imaginez bien que , comme depuis le début de cette « crise », il vaut mieux désigner le virus mutant « hors de contrôle » que les politiciens pour justifier du blocus qu’implique le brexit !

    10000 camions à contrôler par jour rien qu’à Calais et rien n’est prêt !

    Un virus mutant « hors de contrôle » ... smiley

     Les gens sont complétement c.... !

    Notre acteur favori, à la lanterne, doit avoir mal aux côtes tellement c’est drôle ...  smiley


  • vachefolle vachefolle 21 décembre 2020 14:41

    Bravo pour cet article (et je ne dis pas ca tous les jours).

    Effectivement a ce stade le nouveau virus est plus médiatique que médical, mais ceci-dit il est tout a fait possible qu’une mutation vraiment dangereuse arrive tout ou tard avec des centaines de millions de personnes contaminnés, qui peuvent chacun servir de boite de petri darwinienne.


  • Djam Djam 21 décembre 2020 21:20

    La bouffée délirante collective continue... s’y ajoute de plus en plus de comportement paranoïaque, des accès de panique, des dépressions sérieuses et pas mal de suicides qui se font dans le silence assourdissant en-dessous du caquetage compulsif et obsessionnel « covid, covid, covid, covid.... » jusqu’à la démence masquée.


  • fcpgismo fcpgismo 22 décembre 2020 14:10

    Génial,plus fort que notre Nabum.


  • pierrot pierrot 24 décembre 2020 12:43

    Le nouveau variant anglais comporte 23 changements génétiques dont seuls 2 sont à surveiller compte tenu de leur position stratégique sur la protéine de spicule : le N501YC et le P381H.

    Ces 23 mutations n’ont aucun impact sur l’efficacité des actuels vaccins car ils ne facilitent pas l’entrée dans le fameuse serrure AC2 de la cellule.

    Mais a suivre de près leurs éventuelles évolutions.


Réagir